Skip to main content
Verslay
All Use Cases
executive

Competitor Stock and News Monitor

Daily competitor stock moves plus news, distilled into one leadership intel brief for Slack and email.

Best forAgencyB2BSaaSServices
Agents10 required
Duration3-5 minutes

Every morning this recipe watches the public companies you compete with, pulls their latest price move plus the day's news mentions, and turns the raw numbers and headlines into a tight leadership-grade intel digest. Deltas, ranked news, and an analyst 'so what' are assembled in memory and held at an approval gate. Nothing posts to Slack or emails your leadership team until you approve, every fact carries a source, and a stable dedupe key keeps re-runs from double-reporting.

How it runs

Multi-agent orchestration — here's the flow, step by step.

01

Resolve the competitor watch-list from memory (or ask once), normalize to company + ticker + domain, and load prior-run dedupe state.

workflow orchestrator
01

Run the recipient suppression gate first, excluding unsubscribed/do-not-contact/opted-out leadership recipients with reasons before any assembly.

competitive intel
02

Pull latest quote, prior close, day/period delta, and 52-week context per competitor, each with source and as-of timestamp.

market analyst
02

Pull same-day news mentions per competitor in the configured window, capturing headline, source, URL, and published time; drop unsourced items.

web researcher
03

Normalize facts, compute price deltas and vs-last-run trend, flag threshold-crossing moves, and apply the idempotent dedupe keys against prior state.

data analyst
03

Write the per-competitor analyst 'so what', anchored to sourced facts; label unexplained moves rather than inventing a cause.

competitor analysis agent
04

Compose the leadership brief: market-mood header, ranked 'what changed today', per-competitor blocks, and a follow-up watch-list.

executive briefing writer
04

Render one Slack-compact and one email-full version from the same facts so the two never disagree, keeping section order stable across runs.

report formatter
04

Apply leadership-appropriate tone and sign-off from brand voice (or a neutral-executive default), flagging when voice is unset.

internal comms writer
04

Stage the Slack post, leadership email, and log row for approval; on approve, send both and persist today's dedupe fingerprint to memory.

distributor

Required Agents

10
  • workflow-orchestrator
  • competitive-intel
  • web-researcher
  • market-analyst
  • data-analyst
  • competitor-analysis-agent
  • executive-briefing-writer
  • report-formatter
  • internal-comms-writer
  • distributor

Connections

Required

alpha-vantagegmailnewsapislack

Optional

slackgmailresendoutlookgoogle-sheets

What it does

  • Daily competitor stock price deltas with 52-week context
  • Same-day news mention scan, every item source-linked
  • Analyst 'so what' read anchored to sourced facts
  • Unusual-move flagging against a configurable threshold
  • Recipient suppression gate before any push
  • Idempotent dedupe so re-runs never repeat alerts
  • One-click staged push to Slack and leadership email
  • Graceful degradation for private (untradeable) competitors

Example prompt

Every morning, check the stock moves and news for our competitors Salesforce, HubSpot, and Monday.com, write me a short intel brief, and get it ready to post in our #competitive-intel Slack channel and email the leadership team.

Ready to deploy Competitor Stock and News Monitor?

Start free. One click, full agent orchestration.

Get Started Free →